Analytical Data
-
Gene name
OR1E1
- Application
-
Alternative Names
OR1E1; OR1E5; OR1E6; OR1E9P; Olfactory receptor 1E1; Olfactory receptor 13-66; OR13-66; Olfactory receptor 17-2/17-32; OR17-2; OR17-32; Olfactory receptor 1E5; Olfactory receptor 1E6; Olfactory receptor 5-85; OR5-85; Olfactory receptor OR17-18; Olfactory receptor-like protein HGMP07I
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P30953
-
Expression Region
1-314 aa
-
AA Sequence
MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPMY LFLSNLSFSDLCFSSVTIPKLLQNMQNQDPSIPYADCLTQMYFFLLFGDLESFLLVAMAY DRYVAICFPLHYTAIMSPMLCLALVALSWVLTTFHAMLHTLLMARLCFCADNVIPHFFCD MSALLKLAFSDTRVNEWVIFIMGGLILVIPFLLILGSYARIVSSILKVPSSKGICKAFST CGSHLSVVSLFYGTVIGLYLCSSANSSTLKDTVMAMMYTVVTPMLNPFIYSLRNRDMKGA LSRVIHQKKTFFSL
-
Molecular Weight
35.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR1E1, a member of the olfactory receptor gene family, has garnered increasing attention due to its potential roles in sensory perception, particularly in olfaction and its implications in various physiological processes. Research indicates that OR1E1 is expressed in several tissues, not just the olfactory epithelium, suggesting non-canonical functions outside the traditional sensory modalities. Understanding OR1E1 involves exploring its structure-function relationships, ligand binding capabilities, and the downstream signaling pathways it engages. Given the pivotal role of olfactory receptors in environmental interaction and behavior, studies on OR1E1 may uncover insights into its contribution to odor detection, modulation of neuroendocrine responses, and its involvement in diseases linked to sensory processing. Recent advancements in molecular biology techniques have enabled the production of recombinant OR1E1 proteins, allowing for detailed biophysical and biochemical characterization of this receptor. This research not only sheds light on the functional dynamics of OR1E1 but also paves the way for potential therapeutic applications, including the design of odorant-based therapies targeting neurological disorders. Overall, the study of OR1E1 provides a fascinating intersection of sensory biology, genetics, and medicine, highlighting the complexity of receptor signaling in maintaining homeostasis and responding to environmental cues.
