Analytical Data
-
Gene name
OR1F1
- Application
-
Alternative Names
OR1F1; OLFMF; OR1F10; OR1F4; OR1F5; OR1F6; OR1F7; OR1F8; OR1F9; Olfactory receptor 1F1; Olfactory receptor 16-35; OR16-35; Olfactory receptor 1F10; Olfactory receptor 1F4; Olfactory receptor 1F5; Olfactory receptor 1F6; Olfactory receptor 1F7; Olfactory receptor 1F8; Olfactory receptor 1F9; Olfactory receptor OR16-4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43749
-
Expression Region
1-312 aa
-
AA Sequence
MSGTNQSSVSEFLLLGLSRQPQQQHLLFVFFLSMYLATVLGNLLIILSVSIDSCLHTPMY FFLSNLSFVDICFSFTTVPKMLANHILETQTISFCGCLTQMYFVFMFVDMDNFLLAVMAY DHFVAVCHPLHYTAKMTHQLCALLVAGLWVVANLNVLLHTLLMAPLSFCADNAITHFFCD VTPLLKLSCSDTHLNEVIILSEGALVMITPFLCILASYMHITCTVLKVPSTKGRWKAFST CGSHLAVVLLFYSTIIAVYFNPLSSHSAEKDTMATVLYTVVTPMLNPFIYSLRNRYLKGA LKKVVGRVVFSV
-
Molecular Weight
34.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR1F1 is a member of the olfactory receptor gene family, which plays a crucial role in the detection of volatile chemical stimuli, thereby influencing the sense of smell. The research surrounding OR1F1 has gained attention due to its potential implications in various areas, including sensory biology, neurobiology, and even pharmacology. Recent studies have suggested that olfactory receptors, once thought to be exclusively responsible for smell, may also participate in non-sensory functions, such as modulating immune responses and influencing placentation. Additionally, OR1F1's unique expression patterns and its interaction with various ligands have prompted researchers to explore its signaling pathways and potential therapeutic applications. Understanding the structural and functional properties of OR1F1, particularly through the development of recombinant proteins, can provide insights into the molecular mechanisms of olfactory transduction and expand our knowledge of how olfactory receptors contribute to broader physiological processes. Given the growing interest in the non-canonical roles of olfactory receptors, investigating OR1F1 may serve as a valuable model for elucidating new biological functions that extend beyond traditional sensory perception.











