Analytical Data
-
Gene name
ADMR
- Application
-
Alternative Names
GPR182; ADMR; G-Protein coupled receptor 182
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15218
-
Expression Region
1-404aa
-
AA Sequence
MSVKPSWGPGPSEGVTAVPTSDLGEIHNWTELLDLFNHTLSECHVELSQSTKRVVLFALYLAMFVVGLVENLLVICVNWRGSGRAGLMNLYILNMAIADLGIVLSLPVWMLEVTLDYTWLWGSFSCRFTHYFYFVNMYSSIFFLVCLSVDRYVTLTSASPSWQRYQHRVRRAMCAGIWVLSAIIPLPEVVHIQLVEGPEPMCLFMAPFETYSTWALAVALSTTILGFLLPFPLITVFNVLTACRLRQPGQPKSRRHCLLLCAYVAVFVMCWLPYHVTLLLLTLHGTHISLHCHLVHLLYFFYDVIDCFSMLHCVINPILYNFLSPHFRGRLLNAVVHYLPKDQTKAGTCASSSSCSTQHSIIITKGDSQPAAAAPHPEPSLSFQAHHLLPNTSPISPTQPLTPS
-
Molecular Weight
45.3 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ADMR (Adipocyte Differentiation-Related Protein) is a critical protein involved in the regulation of adipocyte differentiation and lipid metabolism. Research on ADMR has gained significance in recent years due to its potential implications in obesity, diabetes, and related metabolic disorders. ADMR functions primarily as an intracellular protein that influences the storage and mobilization of lipids within adipocytes, thereby playing a vital role in maintaining energy homeostasis. Given the rising prevalence of obesity and its associated health complications worldwide, understanding the molecular mechanisms governing adipogenesis and lipid regulation has become more crucial than ever. Advances in recombinant protein technology have allowed scientists to produce and study ADMR at a molecular level, facilitating insights into its structure-function relationships. Through techniques such as protein expression in bacteria or eukaryotic systems, researchers can analyze the properties and biochemical activities of ADMR, leading to the identification of novel therapeutic targets for metabolic diseases. Furthermore, the development of ADMR-based assays for high-throughput screening holds promise for discovering new compounds that can modulate its activity and, by extension, lipid metabolism. Overall, the exploration of ADMR as a recombinant protein underscores the intersection of molecular biology, biotechnology, and medicine, paving the way for innovative strategies to combat metabolic disorders.
