Cat: PA1000-3007

Recombinant mouse Spock3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Spock3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SPOCK3;TICN3;Testican-3

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8BKV0-1

  • Expression Region

    23-436aa

  • AA Sequence

    AAAVAVAGGRSDGGNFLDEKQWLTTISQYDKEVGQWNKFRDEVEDDYFRT WNPGKPFDQALDPAKDPCLKTKCSRHKVCITQDAQTALCISHRRLTHSMK EVGGSHKQWRGLPSSTCKPCPIAYASPVCGSDGHSYSSQCKLEYQACVLG KQISIKCEGRCPCPSDKSMNIGRNVKRACSDLEFREVANRLRDWFKALHE SGSQNKKTKALLRPERSRFDTSILPICKDSLGWMFNRLDTNYDLLLDQSE LGSIYLDKNEQCTKAFFNSCDTYKDSLISNNEWCYCFQRQQDPPCHTELS NIQKRQGIKKLLGQYIPLCDEDGYYKPTQCHGSVGQCWCVDRYGNEVVGS RINGVADCAIDFEISGDFASGDFREWTDDEGEEDDIMNDKDDIEDDDEDE GDDDDDGDVHDGYIVDHHHHHH

  • Molecular Weight

    48 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Spock3, also known as testican-3, is a member of the SPARC (Secreted Protein, Acidic, Rich in Cysteine) family, which plays a critical role in various biological processes, including cell adhesion, migration, and tissue remodeling. Recent studies have suggested that Spock3 may be involved in several physiological and pathological conditions, including tumor progression and neurodegenerative diseases. Its expression is often tissue-specific, and alterations in Spock3 levels have been implicated in cancer metastasis and the modulation of the extracellular matrix. Given its potential as a biomarker and therapeutic target, the recombinant production of Spock3 has garnered significant interest. The generation of recombinant Spock3 protein allows for in-depth functional studies, structural characterization, and assessment of its biological activities in vitro and in vivo. Additionally, understanding the molecular mechanisms regulated by Spock3 can provide insights into its therapeutic potential and role in disease progression. Research focusing on Spock3 could pave the way for novel diagnostic tools and treatment strategies, particularly in oncology and regenerative medicine. Thus, the investigation of recombinant Spock3 protein is not only essential for elucidating its biological functions but also holds promise for advancing medical research and clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US