Analytical Data
-
Gene name
OR1A2
- Application
-
Alternative Names
Olfactory receptor 1A2. Olfactory receptor 17-6. OR17-6. Olfactory receptor OR17-10
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y585
-
AA Sequence
MKKENQSFNLDFILLGVTSQQEQNNVFFVIFLCIYPITLTGNLLIILAICADIRLHNPMYFLLANLSLVDIIFSSVTIPKVLANHLLGSKFISFGGCLMQMYFMIALAKADSYTLAAMAYDRAVAISCPLHYTTIMSPRSCILLIAGSWVIGNTSALPHTLLTASLSFCGNQEVANFYCDIMPLLKLSCSDVHFNVKMMYLGVGVFSLPLLCIIVSYVQVFSTVFQVPSTKSLFKAFCTCGSHLTVVFLYYGTTMGMYFRPLTSYSPKDAVITVMYVAVTPALNPFIYSLRNWDMKAALQKLFSKRISS
-
Molecular Weight
34.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR1A2 is a member of the olfactory receptor gene family, which plays a crucial role in the detection of odorants and the regulation of sensory signaling pathways in the human body. This receptor is primarily expressed in the olfactory epithelium, where it contributes to the perception of a variety of volatile compounds. Its unique structure, characterized by seven transmembrane domains, allows it to interact with specific ligands, leading to cellular responses that are essential for olfaction. Recent studies have highlighted the significance of OR1A2 not only in sensory biology but also in various physiological processes, including immune responses and potential implications in neurological disorders. The recombinant expression of OR1A2 protein is of particular interest for advancing our understanding of its functional characteristics, receptor-ligand interactions, and downstream signaling mechanisms. By employing techniques such as molecular cloning and protein purification, researchers aim to produce and study this receptor in vitro, paving the way for potential applications in biosensors, drug discovery, and therapeutic interventions targeting olfactory signaling pathways. Furthermore, investigating OR1A2 may provide insights into the evolutionary adaptation of olfactory systems among different species and enhance our overall comprehension of sensory modalities in both health and disease states.
