Analytical Data
-
Gene name
OR13D1
- Application
-
Alternative Names
OR13D1; Olfactory receptor 13D1; Olfactory receptor OR9-15
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGV5
-
Expression Region
1-346 aa
-
AA Sequence
MYRFTDFDVSNISIYLNHVLFYTTQQAGDLEHMETRNYSAMTEFFLVGLSQYPELQLFLF LLCLIMYMIILLGNSLLIIITILDSRLHTPMYFFLGNLSFLDICYTSSSIPPMLIIFMSE RKSISFIGCALQMVVSLGLGSTECVLLAVMAYDHYVAICNPLRYSIIMNGVLYVQMAAWS WIIGCLTSLLQTVLTMMLPFCGNNVIDHITCEILALLKLVCSDITINVLIMTVTNIVSLV ILLLLIFISYVFILSSILRINCAEGRKKAFSTCSAHSIVVILFYGSALFMYMKPKSKNTN TSDEIIGLSYGVVSPMLNPIIYSLRNKEVKEAVKKVLSRHLHLLKM
-
Molecular Weight
39.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR13D1 is a member of the olfactory receptor gene family, which plays a crucial role in the detection of various airborne chemicals, contributing to the sense of smell. This particular receptor is encoded by the OR13D1 gene located on human chromosome 1 and is predominantly expressed in the olfactory epithelium. Research into OR13D1 protein focuses on its structural and functional characteristics, as well as its potential implications in olfactory signaling pathways. Understanding OR13D1 is particularly relevant due to its involvement in the perception of diverse odorant molecules, which may correlate with behavioral and physiological responses. Additionally, altered expression or function of olfactory receptors like OR13D1 has been linked to certain neurological disorders and conditions affecting olfaction. The study of recombinant OR13D1 protein facilitates the investigation of its binding affinities and interactions with various ligands, providing insights into the mechanisms of odor recognition and signal transduction. Furthermore, insights gained from OR13D1 could lead to innovative approaches in developing therapeutics for conditions related to olfactory dysfunction, enhancing our understanding of sensory biology and its broader implications in health and disease.
