Analytical Data
-
Gene name
SPINK1
- Application
-
Alternative Names
SPINK1;PSTI;Serine protease inhibitor Kazal-type 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P00995
-
Expression Region
24-79aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSDSLGREAKCYNELNGCTKIYDPVCGTD GNTYPNECVLCFENRKRQTSILIQKSGPC
-
Molecular Weight
9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SPINK1 (Serine Peptidase Inhibitor, Kazal Type 1) is a key protein that plays a significant role in the regulation of serine proteases, which are enzymes implicated in various biological processes, including inflammation, tissue remodeling, and apoptosis. Its overexpression has been associated with several pathological conditions, particularly in pancreatic diseases like chronic pancreatitis and pancreatic cancer, where it acts as a protective factor by inhibiting proteolytic enzymes that can cause tissue damage. Understanding SPINK1 at the molecular level is essential for elucidating its mechanisms in disease pathology and developing potential therapeutic strategies. Recent advances in recombinant protein technology have facilitated the production of SPINK1 in various expression systems, enabling detailed studies into its structure-function relationships and interactions with other proteins. Research involving SPINK1 recombinant proteins aims to clarify its role in disease mechanisms, explore its potential as a biomarker, and investigate its therapeutic applications, such as in enzyme replacement therapies or as a target for drug development. This line of inquiry not only enhances our understanding of protease inhibition but also opens new avenues for tackling diseases where SPINK1 dysregulation is a contributing factor.
