Cat: PA1000-3002

Recombinant Human SPINK1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SPINK1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SPINK1;PSTI;Serine protease inhibitor Kazal-type 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P00995

  • Expression Region

    24-79aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSDSLGREAKCYNELNGCTKIYDPVCGTD GNTYPNECVLCFENRKRQTSILIQKSGPC

  • Molecular Weight

    9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SPINK1 (Serine Peptidase Inhibitor, Kazal Type 1) is a key protein that plays a significant role in the regulation of serine proteases, which are enzymes implicated in various biological processes, including inflammation, tissue remodeling, and apoptosis. Its overexpression has been associated with several pathological conditions, particularly in pancreatic diseases like chronic pancreatitis and pancreatic cancer, where it acts as a protective factor by inhibiting proteolytic enzymes that can cause tissue damage. Understanding SPINK1 at the molecular level is essential for elucidating its mechanisms in disease pathology and developing potential therapeutic strategies. Recent advances in recombinant protein technology have facilitated the production of SPINK1 in various expression systems, enabling detailed studies into its structure-function relationships and interactions with other proteins. Research involving SPINK1 recombinant proteins aims to clarify its role in disease mechanisms, explore its potential as a biomarker, and investigate its therapeutic applications, such as in enzyme replacement therapies or as a target for drug development. This line of inquiry not only enhances our understanding of protease inhibition but also opens new avenues for tackling diseases where SPINK1 dysregulation is a contributing factor.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US