Cat: PA2000-9878

Recombinant Human OR13C4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    OR13C4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    OR13C4; Olfactory receptor 13C4; Olfactory receptor OR9-7

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8NGS5

  • Expression Region

    1-318 aa

  • AA Sequence

    MDKINQTFVREFILLGLSGYPKLEIIFFALILVMYVVILIGNGVLIIASILDSRLHMPMY FFLGNLSFLDICYTTSSIPSTLVSLISKKRNISFSGCAVQMFFGFAMGSTECFLLGMMAF DRYVAICNPLRYPIIMNKVVYVLLTSVSWLSGGINSTVQTSLAMRWPFCGNNIINHFLCE ILAVLKLACSDISVNIVTLAVSNIAFLVLPLLVIFFSYMFILYTILRTNSATGRHKAFST CSAHLTVVIIFYGTIFFMYAKPKSQDLLGKDNLQATEGLVSMFYGVVTPMLNPIIYSLRN KDVKAAIKYLLSRKAINQ

  • Molecular Weight

    35.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

OR13C4 is a member of the olfactory receptor family, which plays a crucial role in the sensory perception of smell in mammals. This receptor, like other olfactory receptors, is embedded in the cell membranes of olfactory sensory neurons and is responsible for detecting specific odorant molecules. The study of OR13C4 has garnered attention due to its potential involvement in various physiological and pathological processes, including its implications in the perception of pheromones and other volatile compounds. Furthermore, understanding the structure and function of OR13C4 can provide insights into the molecular mechanisms behind olfactory signaling pathways, which are critical for behaviors related to reproduction, foraging, and social interactions in animals. The expression and characterization of recombinant OR13C4 protein are essential for elucidating its functional properties and interaction with specific ligands. Advances in recombinant protein technology allow researchers to produce large quantities of purified OR13C4, enabling in vitro studies and functional assays. Additionally, the exploration of OR13C4's interactions with different odorants can contribute to the development of novel applications in the fields of fragrance design, flavor enhancement, and even therapeutic strategies targeting olfactory dysfunction. As research on olfactory receptors progresses, understanding the role of OR13C4 in the broader context of sensory biology remains an exciting and promising area of investigation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US