Analytical Data
-
Gene name
OR10S1
- Application
-
Alternative Names
OR10S1; Olfactory receptor 10S1; Olfactory receptor OR11-279
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGN2
-
Expression Region
1-331 aa
-
AA Sequence
MTSRSVCEKMTMTTENPNQTVVSHFFLEGLRYTAKHSSLFFLLFLLIYSITVAGNLLILL TVGSDSHLSLPMYHFLGHLSFLDACLSTVTVPKVMAGLLTLDGKVISFEGCAVQLYCFHF LASTECFLYTVMAYDRYLAICQPLHYPVAMNRRMCAEMAGITWAIGATHAAIHTSLTFRL LYCGPCHIAYFFCDIPPVLKLACTDTTINELVMLASIGIVAAGCLILIVISYIFIVAAVL RIRTAQGRQRAFSPCTAQLTGVLLYYVPPVCIYLQPRSSEAGAGAPAVFYTIVTPMLNPF IYTLRNKEVKHALQRLLCSSFRESTAGSPPP
-
Molecular Weight
36.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR10S1 is a member of the olfactory receptor family, which plays a significant role in the detection of odorant molecules, contributing to the sense of smell. Given that olfactory receptors are G protein-coupled receptors (GPCRs), they are critical for various physiological processes, including the modulation of behavior and emotion through olfactory stimuli. The study of OR10S1 and its recombinant protein is essential to unravel the underlying mechanisms of olfaction and its potential implications in neurobiology and sensory systems. Recent research has indicated that OR10S1 may have roles beyond olfaction, including potential interactions in non-sensory tissues and involvement in various signaling pathways. Understanding its structure, ligand interactions, and functional dynamics could provide insights into how changes in olfactory signaling may influence health and disease states, such as neurodegenerative disorders or psychiatric conditions. The recombinant production of OR10S1 facilitates detailed biochemical and biophysical studies, allowing researchers to explore its functional characteristics and potential therapeutic applications. As advancements in recombinant protein technology continue to evolve, the functional analysis of OR10S1 through these methods holds promise for expanding our knowledge of GPCR biology and the breadth of olfactory receptor functions in both scientific and clinical contexts. Thus, investigating the OR10S1 recombinant protein not only aids in characterizing this specific receptor but also contributes to the broader understanding of the complexities of sensory perception and signaling in humans.
