Analytical Data
-
Gene name
OR10P1
- Application
-
Alternative Names
OR10P1; OR10P1P; OR10P2P; OR10P3P; Olfactory receptor 10P1; Olfactory receptor 10P2; Olfactory receptor 10P3; Olfactory receptor OR12-7
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGE3
-
Expression Region
1-313 aa
-
AA Sequence
MAGENHTTLPEFLLLGFSDLKALQGPLFWVVLLVYLVTLLGNSLIILLTQVSPALHSPMY FFLRQLSVVELFYTTDIVPRTLANLGSPHPQAISFQGCAAQMYVFIVLGISECCLLTAMA YDRYVAICQPLRYSTLLSPRACMAMVGTSWLTGIITATTHASLIFSLPFRSHPIIPHFLC DILPVLRLASAGKHRSEISVMTATIVFIMIPFSLIVTSYIRILGAILAMASTQSRRKVFS TCSSHLLVVSLFFGTASITYIRPQAGSSVTTDRVLSLFYTVITPMLNPIIYTLRNKDVRR ALRHLVKRQRPSP
-
Molecular Weight
34.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR10P1 is a member of the olfactory receptor gene family, which plays a pivotal role in the perception of odors in the mammalian olfactory system. Recent studies have indicated that OR10P1 is not only involved in traditional olfactory processes but may also play significant roles in non-olfactory biological functions, including specific physiological responses and potential involvement in various diseases. The interest in this receptor is heightened by its unique expression patterns and the possibility of its role in cellular signaling pathways. As a G-protein-coupled receptor (GPCR), OR10P1 interacts with various molecular ligands, which suggests its relevance in receptor-mediated signal transduction. Research into the recombinant expression of OR10P1 provides important insights into its structure-function relationships, ligand specificity, and potential therapeutic applications. Furthermore, understanding the mechanisms underlying OR10P1 activity could pave the way for novel strategies in drug development, targeting GPCRs for conditions impacted by olfactory dysfunction or other receptor-mediated processes. Given its implications across various fields, from pharmacology to neurobiology, OR10P1 represents an exciting area of investigation that could illuminate new aspects of receptor biology and its influence on health and disease.
