Cat: PA1000-2981

Recombinant Human SNTN Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SNTN

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SNTN;S100A1L;Sentan

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    A6NMZ2

  • Expression Region

    1-147aa

  • AA Sequence

    GSSHHHHHHSSGLVPRGSHMGGCMHSTQDKSLHLEGDPNPSAAPTSTCAP RKMPKRISISKQLASVKALRKCSDLEKAIATTALIFRNSSDSDGKLEKAI AKDLLQTQFRNFAEGQETKPKYREILSELDEHTENKLDFEDFMILLLSIT VMSDLLQNIRNVKIMK

  • Molecular Weight

    19 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SNTN, or Stathmin1, is a well-characterized protein that plays a crucial role in cellular processes such as microtubule dynamics, cell signaling, and differentiation. Its dysregulation has been implicated in various pathological conditions, including cancer and neurodegenerative diseases. SNTN affects microtubule stability by binding to tubulin, thereby influencing cell shape, motility, and proliferation. As researchers continue to explore the intricate mechanisms by which SNTN contributes to disease progression, the production of recombinant SNTN proteins has become increasingly important for studying its function and interactions in vitro. These recombinant proteins facilitate detailed investigations into the biochemical and biophysical properties of SNTN, allowing for high-throughput screening of potential therapeutic agents that could modulate its activity. Furthermore, expressing and purifying SNTN in a controlled laboratory setting enables researchers to unravel its role in cytoskeletal dynamics and its interaction with other signaling molecules, providing insights that could lead to novel therapeutic strategies aimed at restoring normal cellular function in diseases associated with SNTN dysregulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US