Analytical Data
-
Gene name
SNRPF
- Application
-
Alternative Names
SNRPF;PBSCF;Small nuclear ribonucleoProtein F
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P62306
-
Expression Region
1-86aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMSLPLNPKPFLNGLTGKPVMVKLKWGMEYK GYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVL YIRGVEEEEEDGEMRE
-
Molecular Weight
12 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SNRPF (Small Nuclear Ribonucleoprotein Protein F) is a crucial component of the spliceosome complex, which plays a significant role in the post-transcriptional modification of pre-mRNA through the splicing process. Recent studies have highlighted the importance of SNRPF in the regulation of gene expression and its involvement in various cellular processes, including cell proliferation and apoptosis. Dysregulation of splicing factors like SNRPF has been linked to several diseases, particularly cancers and neurodegenerative disorders. Understanding the structure and function of SNRPF is vital for elucidating its role in splicing and its impact on cellular health. Researchers are increasingly focused on the recombinant production of SNRPF to facilitate in-depth studies of its biochemical properties and interactions. This research aims not only to clarify SNRPF’s mechanisms of action but also to explore its potential as a therapeutic target or biomarker. The development of recombinant SNRPF will allow for the screening of small molecules that may modulate splicing activity, paving the way for novel therapeutic strategies in splicing-related diseases. Overall, the study of SNRPF is poised to provide significant insights into the fundamental processes of gene regulation and their implications in health and disease.
