Cat: PA1000-2978

Recombinant Human SNRPF Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SNRPF

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SNRPF;PBSCF;Small nuclear ribonucleoProtein F

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P62306

  • Expression Region

    1-86aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMSLPLNPKPFLNGLTGKPVMVKLKWGMEYK GYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVL YIRGVEEEEEDGEMRE

  • Molecular Weight

    12 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SNRPF (Small Nuclear Ribonucleoprotein Protein F) is a crucial component of the spliceosome complex, which plays a significant role in the post-transcriptional modification of pre-mRNA through the splicing process. Recent studies have highlighted the importance of SNRPF in the regulation of gene expression and its involvement in various cellular processes, including cell proliferation and apoptosis. Dysregulation of splicing factors like SNRPF has been linked to several diseases, particularly cancers and neurodegenerative disorders. Understanding the structure and function of SNRPF is vital for elucidating its role in splicing and its impact on cellular health. Researchers are increasingly focused on the recombinant production of SNRPF to facilitate in-depth studies of its biochemical properties and interactions. This research aims not only to clarify SNRPF’s mechanisms of action but also to explore its potential as a therapeutic target or biomarker. The development of recombinant SNRPF will allow for the screening of small molecules that may modulate splicing activity, paving the way for novel therapeutic strategies in splicing-related diseases. Overall, the study of SNRPF is poised to provide significant insights into the fundamental processes of gene regulation and their implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US