Analytical Data
-
Gene name
OR10G3
- Application
-
Alternative Names
OR10G3; Olfactory receptor 10G3; Olfactory receptor OR14-40
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGC4
-
Expression Region
1-313 aa
-
AA Sequence
MERINSTLLTAFILTGIPYPLRLRTLFFVFFFLIYILTQLGNLLILITVWADPRLHARPMYIFLGVLSVIDMSISSIIVPRLMMNFTLGVKPIPFGGCVAQLYFYHFLGSTQCFLYTLMAYDRYLAICQPLRYPVLMTAKLSALLVAGAWMAGSIHGALQAILTFRLPYCGPNQVDYFFCDIPAVLRLACADTTVNELVTFVDIGVVVASCFSLILLSYIQIIQAILRIHTADGRRRAFSTCGAHVTVVTVYYVPCAFIYLRPETNSPLDGAAALVPTAITPFLNPLIYTLRNQEVKLALKRMLRSPRTPSEV
-
Molecular Weight
61.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR10G3, a member of the olfactory receptor gene family, has garnered significant interest in recent years due to its potential implications in sensory biology and human disease. These receptors are primarily known for their role in the detection of odorants, but emerging studies have suggested that they may also play a role in various physiological processes beyond olfaction. The OR10G3 protein, in particular, is expressed in several tissues, indicating a broader functional relevance that may extend to tumor biology and immune responses. Research has shown that certain olfactory receptors, including OR10G3, might be involved in signaling pathways related to cancer progression and metastasis. Additionally, the ability of these receptors to interact with non-olfactory ligands raises intriguing possibilities for their therapeutic targeting. Recent advances in recombinant protein technology have allowed for the expression and purification of OR10G3, facilitating in-depth studies into its structural characteristics and ligand-binding properties. Understanding the biological role of OR10G3 through recombinant techniques may uncover novel insights into its functional mechanisms and open avenues for innovative therapeutic strategies in treating diseases linked to its dysregulation. Thus, the study of OR10G3 not only enhances our fundamental understanding of olfactory receptors but also highlights their potential as biomarkers and targets in clinical applications.
