Cat: PA2000-1248

Recombinant Human HDAC10 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HDAC10

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HDAC10;Polyamine deacetylase HDAC10

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q969S8

  • Expression Region

    1-482aa

  • AA Sequence

    MGTALVYHEDMTATRLLWDDPECEIERPERLTAALDRLRQRGLEQRCLRL SAREASEEELGLVHSPEYVSLVRETQVLGKEELQALSGQFDAIYFHPSTF HCARLAAGAGLQLVDAVLTGAVQNGLALVRPPGHHGQRAAANGFCVFNNV AIAAAHAKQKHGLHRILVVDWDVHHGQGIQYLFEDDPSVLYFSWHRYEHG RFWPFLRESDADAVGRGQGLGFTVNLPWNQVGMGNADYVAAFLHLLLPLA FEFDPELVLVSAGFDSAIGDPEGQMQATPECFAHLTQLLQVLAGGRVCAV LEGGYHLESLAESVCMTVQTLLGDPAPPLSGPMAPCQSALESIQSARAAQ APHWKSLQQQDVTAVPMSPSSHSPEGRPPPLLPGGPVCKAAASAPSSLLD QPCLCPAPSVRTAVALTTPDITLVLPPDVIQQEASALREETEAWARPHES LAREEALTALGKLLYLLDGMLDGQVNSGIAAT

  • Molecular Weight

    71 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Histone deacetylase 10 (HDAC10) is a member of the HDAC family, which plays a crucial role in the regulation of gene expression by removing acetyl groups from histones, leading to chromatin condensation and transcriptional repression. Unlike other HDACs, HDAC10 is primarily localized in the cytoplasm and has been implicated in various cellular processes, including cell cycle regulation, differentiation, and apoptosis. Recent studies have highlighted its involvement in several diseases, particularly cancer, where altered HDAC activity contributes to tumorigenesis and poor prognosis. Given its distinct functional characteristics and the potential for HDAC inhibitors as therapeutic agents, HDAC10 has garnered attention as a novel target for drug development. The need for a better understanding of HDAC10's structure and function has propelled research into its recombinant protein expression and purification, allowing for detailed biochemical and biophysical analyses. By utilizing recombinant HDAC10, researchers aim to elucidate its enzymatic properties, identify its substrates, and explore its regulatory mechanisms, thereby providing insights that could lead to the development of targeted therapies for diseases associated with HDAC dysregulation. This research is pivotal in advancing our knowledge of epigenetic regulation and its implications for health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US