Analytical Data
-
Gene name
ODZ1
- Application
-
Alternative Names
TENM1; ODZ1; TNM1; Teneurin-1; Ten-1; Protein Odd Oz/ten-m homolog 1; Tenascin-M1; Ten-m1; Teneurin transmembrane protein 1) [Cleaved into: Ten-1 intracellular domain; IDten-1; Ten-1 ICD); Teneurin C-terminal-associated peptide; TCPA-1; Ten-1 extracellular domain; Ten-1 ECD)]
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UKZ4
-
Expression Region
2616-2725 aa
-
AA Sequence
TRRFADIQLQHGALCFNIRYGTTVEEEKNHVLEIARQRAVAQAWTKEQRRLQEGEEGIRAWTEGEKQQLLSTGRVQGYDGYFVLSVEQYLELSDSANNIHFMRQSEIGRR
-
Molecular Weight
37.84 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of ODZ1 recombinant protein has gained significance due to its potential role in neurodevelopment and synaptic function. ODZ1, a member of the ODZ (odd Oz) protein family, is involved in neuronal differentiation and the formation of synapses, which are critical for effective communication between neurons. Researchers have observed that mutations or alterations in the ODZ1 gene are associated with neurological disorders, including schizophrenia and autism spectrum disorders. By producing recombinant ODZ1 protein, scientists aim to elucidate its structure, function, and interaction with other synaptic proteins, thus improving our understanding of its developmental and pathological roles. Furthermore, characterizing ODZ1 can lead to the identification of novel therapeutic targets for treating neurological conditions. As a result, ODZ1 protein research is not only pivotal in deciphering fundamental neurobiological processes but also holds promise for advancing therapeutic strategies in neuropsychiatric disorders. The development of effective recombinant expression systems and subsequent studies on the biochemical properties of ODZ1 will facilitate a deeper exploration of its mechanisms, ultimately contributing to our understanding of brain function and dysfunction.
