Analytical Data
-
Gene name
NT5C1B
- Application
-
Alternative Names
NT5C1B；AIRP；Cytosolic 5'-nucleotidase 1B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96P26
-
Expression Region
1-610aa
-
AA Sequence
MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQMRRAVNPNHSLRCCPFQGHSSCRRCLCAAEGTALGPCHTIRIYIHMCLLWEQGQQITMMRGSQESSLRKTDSRGYLVRSQWSRISRSPSTKAPSIDEPRSRNTSAKLPSSSTSSRTPSTSPSLHDSSPPPLSGQPSLQPPASPQLPRSLDSRPPTPPEPDPGSRRSTKMQENPEAWAQGIVREIRQTRDSQPLEYSRTSPTEWKSSSQRRGIYPASTQLDRNSLSEQQQQQREDEDDYEAAYWASMRSFYEKNPSCSRPWPPKPKNAITIALSSCALFNMVDGRKIYEQEGLEKYMEYQLTNENVILTPGPAFRFVKALQYVNARLRDLYPDEQDLFDIVLMTNNHAQVGVRLINSVNHYGLLIDRFCLTGGKDPIGYLKAYLTNLYIAADSEKVQEAIQEGIASATMFDGAKDMAYCDTQLRVAFDGDAVLFSDESEHFTKEHGLDKFFQYDTLCESKPLAQGPLKGFLEDLGRLQKKFYAKNERLLCPIRTYLVTARSAASSGARVLKTLRRWGLEIDEALFLAGAPKSPILVKIRPHIFFDDHMFHIEGAQRLGSIAAYGFNKKFSS
-
Molecular Weight
68.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NT5C1B, or nucleoside triphosphate diphosphohydrolase 1B, is an enzyme that plays a crucial role in nucleotide metabolism, particularly in the hydrolysis of nucleotides. This enzyme is involved in the regulation of nucleotide levels within cells, contributing to various cellular processes such as signal transduction, energy metabolism, and RNA synthesis. Dysregulation of NT5C1B has been implicated in several pathological conditions, including cancer, where altered nucleotide metabolism can lead to uncontrolled cell proliferation and resistance to therapies. Additionally, NT5C1B has been linked to neurodegenerative diseases, raising interest in its potential as a therapeutic target. Recent research has focused on characterizing the structure and function of NT5C1B, with recombinant protein studies aimed at elucidating its catalytic mechanisms and substrate specificity. The production of NT5C1B as a recombinant protein allows for extensive biochemical and biophysical analyses, which can provide insights into its role in cellular physiology and its potential as a drug target. Investigating NT5C1B at the molecular level may pave the way for the development of novel therapeutics aimed at modulating nucleotide metabolism in various disease contexts, highlighting the significance of this enzyme in both basic and applied biomedical research.
