Analytical Data
-
Gene name
ORCAM
- Application
-
Alternative Names
ORCAM；
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A0A7G5CF76
-
Expression Region
1-155aa
-
AA Sequence
MAEGLSDERIVELKEAFNLFDKDGDGFITTSELGIVMTSLNQNPSDGELQDMINEVDADGNGTIDFNEFLRMMARKAKETDIDEELRQAFKVFDRDGNGFISADELRQVMSNLGEKLTDDEVDEMIKEADVDGDGQVNYEEFVKLMTTRQTDASN
-
Molecular Weight
17.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Orcam, known for its innovative approaches in biotechnology, focuses on the development of recombinant proteins that have significant applications in various fields such as medicine, agriculture, and industrial biotechnology. The research background of Orcam’s recombinant protein studies stems from the need for effective and sustainable solutions to address global challenges, including disease management, food security, and environmental sustainability. By employing advanced genetic engineering techniques, Orcam aims to produce proteins that can enhance therapeutic efficacy, improve crop resilience, and facilitate bioprocessing applications. The company’s research is rooted in a thorough understanding of protein structure and function, enabling the design of tailor-made proteins with specific characteristics. This work is vital not only for the pharmaceutical industry, where recombinant proteins are used as drugs or therapeutic agents, but also for developing biopesticides and biofertilizers in agriculture. Challenges such as the need for more efficient production methods and the scalability of these proteins are central to Orcam's ongoing research, driving innovations that leverage synthetic biology and bioprocess optimization. Overall, Orcam's focus on recombinant protein research is positioned to contribute meaningfully to the advancement of science and technology, with the potential for significant societal impacts.
