Analytical Data
-
Gene name
SH3BGRL3
- Application
-
Alternative Names
SH3BGRL3;SH3 domain-binding glutamic acid-rich-like Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H299
-
Expression Region
1-93aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMSGLRVYSTSVTGSREIKSQQSEVTRI LDGKRIQYQLVDISQDNALRDEMRALAGNPKATPPQIVNGDQYCGDYELF VEAVEQNTLQEFLKLA
-
Molecular Weight
13 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SH3BGRL3 (SH3 Domain-Binding Protein 3-Like 3) is a protein that has garnered attention due to its potential roles in various cellular processes, including signal transduction, cytoskeletal organization, and cell motility. Emerging research indicates that SH3BGRL3 may play a critical role in regulating protein interactions through its SH3 (Src Homology 3) domain, which is known to mediate interactions with other proteins that are pivotal in signaling pathways. Studies have indicated that dysregulation of SH3BGRL3 expression could be associated with various pathological conditions, including cancer and neurodegenerative diseases. The interest in SH3BGRL3 is fueled by its potential therapeutic implications; understanding its functional mechanisms could lead to novel strategies for pharmacological intervention. Additionally, the study of SH3BGRL3's interactions with other proteins has implications in elucidating the complex molecular networks that govern cellular behavior. Recombinant production of SH3BGRL3 enables researchers to investigate its structure-function relationships, explore its binding partners, and assess its functional roles in different biological contexts. Investigating SH3BGRL3 is, therefore, crucial for unraveling its significance in health and disease, as well as for developing targeted therapeutic approaches based on its molecular activities.
