Cat: PA2000-1218

Recombinant Human CAV3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CAV3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CAV3;Caveolin-3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P56539

  • Expression Region

    1-83aa

  • AA Sequence

    MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVG TYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVP

  • Molecular Weight

    35 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CAV3 (Caveolin-3) is a muscle-specific protein that plays a crucial role in the formation of caveolae, small invaginations in the plasma membrane of cells, particularly in cardiac and skeletal muscle tissues. Its involvement in various cellular processes, including signal transduction, lipid metabolism, and membrane trafficking, has made CAV3 a significant focus of research in cell biology and pathology. Mutations in the CAV3 gene are associated with several muscular diseases, including Limb-Girdle Muscular Dystrophy and Rippling Muscle Disease, highlighting its importance in muscle integrity and function. Moreover, CAV3 has been implicated in the pathogenesis of cardiovascular diseases, as it interacts with signaling molecules that regulate vascular smooth muscle contraction and endothelial function. The production of recombinant CAV3 protein allows researchers to investigate its structure-function relationships, post-translational modifications, and interactions with other proteins in detail. Understanding these aspects is crucial for elucidating the molecular mechanisms underlying the diseases linked to CAV3 dysfunction. Additionally, recombinant CAV3 can serve as a potential therapeutic target or biomarker for muscle-related disorders. Recent advancements in protein expression systems have facilitated the generation of high-purity CAV3 for use in biophysical and biochemical studies, which are essential for developing novel therapeutic strategies aimed at mitigating CAV3-related pathologies. Overall, research on recombinant CAV3 protein is paving the way for deeper insights into its biological significance and potential applications in regenerative medicine and targeted therapies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US