Analytical Data
-
Gene name
NRSN2
- Application
-
Alternative Names
NRSN2; C20orf98; Neurensin-2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9GZP1
-
Expression Region
1-204 aa
-
AA Sequence
MMPSCNRSCSCSRGPSVEDGKWYGVRSYLHLFYEDCAGTALSDDPEGPPVLCPRRPWPSLCWKISLSSGTLLLLLGVAALTTGYAVPPKLEGIGEGEFLVLDQRAADYNQALGTCRLAGTALCVAAGVLLAICLFWAMIGWLSQDTKAEPLDPEADSHVEVFGDEPEQQLSPIFRNASGQSWFSPPASPFGQSSVQTIQPKRDS
-
Molecular Weight
48.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NRSN2, or Neuronal Regulator of Synaptic Neogenesis 2, is a protein that plays a crucial role in synaptic plasticity and neuronal development, making it a significant focus in neuroscience research. It is involved in the regulation of synaptic signaling and has been implicated in various neurological disorders, including schizophrenia and autism spectrum disorders. Researchers are increasingly interested in understanding the molecular mechanisms by which NRSN2 influences synapse formation and maintenance, as these processes are vital for brain function and cognition. The generation of recombinant NRSN2 protein allows for detailed biochemical and biophysical studies, enabling scientists to investigate its interactions with other synaptic proteins and its potential role as a therapeutic target. By analyzing the activity and function of NRSN2 in vitro and in vivo, researchers aim to uncover its contributions to neurodevelopmental processes and synaptic integrity. This research not only enhances our understanding of fundamental neuronal mechanisms but also paves the way for potential interventions in the treatment of synaptic-related disorders. The ongoing studies on NRSN2 and its recombinant protein are poised to reveal critical insights into the complexities of neural networks and their implications for mental health.
