Analytical Data
-
Gene name
NRXN1
- Application
-
Alternative Names
NRXN1; Neurexin-1-beta; Neurexin I-beta
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P58400
-
Expression Region
1-31-130 aa
-
AA Sequence
LEFPGAEGQWTRFPKWNACCESEMSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLFI
-
Molecular Weight
36.74 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NRXN1 (Neurexin 1) is a crucial gene implicated in synaptic function and has garnered significant interest in neurobiological research, particularly concerning neurodevelopmental and psychiatric disorders. Neurexins are a family of cell adhesion proteins that play pivotal roles in establishing and maintaining synapses by facilitating communication between neurons. Mutations and deletions in the NRXN1 gene have been associated with various conditions, including autism spectrum disorders, schizophrenia, and intellectual disability, highlighting its importance in neural development and function. The study of NRXN1 recombinant proteins is essential for understanding the molecular mechanisms underlying these conditions, as well as for exploring their role in synaptic plasticity and connectivity. Through the production and characterization of NRXN1 recombinant proteins, researchers can investigate the structure-function relationship, interaction with ligands, and the effects of disease-associated mutations. This research not only aids in elucidating the biological pathways affected by NRXN1 dysfunction but also has the potential to inform the development of therapeutic strategies targeting neurodevelopmental disorders. By using advanced techniques such as x-ray crystallography, NMR spectroscopy, and various biochemical assays, scientists aim to reveal the intricate details of NRXN1’s function and its contribution to synaptic architecture, ultimately enhancing our understanding of brain function and pathology.
