Analytical Data
-
Gene name
NRSN1
- Application
-
Alternative Names
NRSN1; VMP; Neurensin-1; Neuro-p24; Vesicular membrane protein of 24 kDa; Vesicular membrane protein p24
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IZ57
-
Expression Region
1-195 aa
-
AA Sequence
MSSCSNVCGSRQAQAAAEGGYQRYGVRSYLHQFYEDCTASIWEYEDDFQIQRSPNRWSSVFWKVGLISGTVFVILGLTVLAVGFLVPPKIEAFGEADFVVVDTHAVQFNSALDMYKLAGAVLFCIGGTSMAGCLLMSVFVKSYSKEEKFLQQKFKERIADIKAHTQPVTKAPGPGETKIPVTLSRVQNVQPLLAT
-
Molecular Weight
47.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NRSN1 (Neuronal Regeneration Related 1) is a protein that has gained significant interest in neuroscience and regenerative medicine due to its potential role in neuronal survival and repair. Research has indicated that NRSN1 is involved in various cellular processes, including neuronal signaling, synaptic plasticity, and stress responses, highlighting its importance in maintaining neuronal health and function. Dysregulation of NRSN1 has been linked to neurodegenerative diseases and neuronal injuries, making it a target for therapeutic interventions. The recombinant expression of NRSN1 allows for the detailed study of its function and mechanisms in cellular models, facilitating the identification of pathways that could be harnessed for therapeutic purposes. Furthermore, understanding the structure-function relationship of NRSN1 through recombination techniques could lead to the development of novel strategies to promote neuronal regeneration and recovery following injury or disease. Ongoing studies aim to elucidate the specific mechanisms through which NRSN1 exerts its effects, potentially offering new insights into the treatment of conditions like Alzheimer’s disease, Parkinson’s disease, and traumatic brain injuries. The successful expression and characterization of NRSN1 in recombinant systems thus represents a promising avenue for advancing our understanding of neuronal biology and developing innovative therapeutic approaches.
