Analytical Data
-
Gene name
NRIP1
- Application
-
Alternative Names
NRIP 1; NRIP1; NRIP1_HUMAN; Nuclear factor RIP 140; Nuclear factor RIP140; Nuclear receptor interacting protein 1; Nuclear receptor-interacting protein 1; Receptor interacting protein 140; Receptor-interacting protein 140; RIP 140; RIP140
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P48552
-
Expression Region
1051-1158 aa
-
AA Sequence
KNEYEKDSPRLTKTNPILYYMLQKGGNSVTSRETQDKDIWREASSAESVSQVTAKEELLPTAETKASFFNLRSPYNSHMGNNASRPHSANGEVYGLLGSVLTIKKESE
-
Molecular Weight
37.62 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NRIP1, also known as Nuclear Receptor Interacting Protein 1, is a co-regulator that plays a crucial role in the regulation of various nuclear receptors and gene expression. Its involvement in multiple biological processes, including metabolism, immune response, and cell differentiation, has garnered significant interest in the scientific community. Dysregulation of NRIP1 has been implicated in various diseases, including cancer and metabolic disorders, highlighting its potential as a therapeutic target. Research on NRIP1 often focuses on its molecular interactions and functions, aiming to elucidate the mechanisms through which it influences gene transcription and cellular signaling pathways. The use of recombinant protein technology to produce NRIP1 allows for detailed structural and functional studies, facilitating insights into its role in health and disease. Furthermore, understanding the dynamics of NRIP1's interactions with other proteins and nuclear receptors can lead to the identification of novel drug targets and therapeutic strategies. Overall, NRIP1 continues to be a prominent subject of research, with the potential to contribute significantly to our understanding of gene regulation and disease pathology.
