Analytical Data
-
Gene name
SEC22B
- Application
-
Alternative Names
SEC22B;SEC22L1;Vesicle-trafficking Protein SEC22b
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75396
-
Expression Region
14-194aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMLPLAASMQEDEQSGRDLQQYQSQAKQ LFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLE DLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSIN TELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKYRQDAKYLNM RSTYA
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SEC22B, a member of the SEC22 protein family, plays a crucial role in intracellular transport and membrane trafficking, particularly in the secretory pathway of eukaryotic cells. As a soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE), SEC22B is implicated in the fusion of transport vesicles with target membranes, contributing to the release of proteins and other cargoes critical for various cellular functions. Research has shown that SEC22B is involved in the secretion of insulin from pancreatic beta-cells, making it a potential target for understanding diabetes pathophysiology. Additionally, its role in the endoplasmic reticulum-Golgi network dynamics highlights its importance in maintaining cellular homeostasis. Mutations or dysregulation of SEC22B may lead to various pathological conditions, including neurodegenerative diseases and cancer. Consequently, studying SEC22B not only enhances our understanding of fundamental cellular processes but also paves the way for potential therapeutic interventions. The recombinant expression of SEC22B has enabled scientists to investigate its structure, function, and interactions with other SNARE proteins, providing insights into the mechanisms governing membrane fusion and cargo delivery. This research is pivotal for elucidating the molecular underpinnings of exocytosis and its implications in health and disease.
