Analytical Data
-
Gene name
NOS2A
- Application
-
Alternative Names
HEP-NOS; Hepatocyte NOS; HEPNOS ; inducible; Inducible nitric oxide synthase ; Inducible NO synthase; Inducible NOS; iNOS; MAC NOS; Macrophage NOS; Nitric oxide synthase 2 inducible; Nitric oxide synthase 2 inducible macrophage ; nitric oxide synthase 2A (inducible. hepatocytes); Nitric oxide synthase; Nitric oxide synthase inducible ; nitric oxide synthase. macrophage; NOS 2; NOS; Nos II; NOS type II; nos2; NOS2_HUMAN; NOS2A; NOS2A. Inducible. Hepatocyte; Peptidyl-cysteine S-nitrosylase NOS2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P35228
-
Expression Region
685-794 aa
-
AA Sequence
DVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDLSKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQPALVQGILERVVDG
-
Molecular Weight
37.84 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NOS2A, or inducible nitric oxide synthase, is an enzyme that plays a crucial role in the immune response and various pathological conditions, including inflammation and neurodegenerative diseases. The study of NOS2A recombinant proteins has garnered significant interest due to their potential applications in therapeutic interventions and understanding underlying molecular mechanisms. NOS2A is responsible for the production of nitric oxide (NO), a signaling molecule with diverse biological functions that include modulating vascular tone, neurotransmission, and immune responses. Dysregulation of NO production is implicated in various diseases, such as sepsis, cancer, and autoimmune disorders. By generating NOS2A recombinant proteins, researchers aim to elucidate the enzyme's structural and functional characteristics, assess its regulatory mechanisms, and explore its interactions within cellular pathways. This line of research not only advances our comprehension of NOS2A's role in health and disease but also holds promise for developing targeted therapies that modulate NO synthesis. Overall, the investigation of NOS2A recombinant proteins serves as a fundamental step toward innovative biomedical applications and enhancing our understanding of nitric oxide's complex biology.
