Analytical Data
-
Gene name
SDF1
- Application
-
Alternative Names
CXCL12;SDF1;SDF1A;SDF1B;Stromal cell-derived factor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P48061
-
Expression Region
22-89aa
-
AA Sequence
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVC IDPKLKWIQEYLEKALNK
-
Molecular Weight
8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SDF1, or Stromal-Derived Factor 1, is a chemokine that plays a critical role in the regulation of immune responses and the migration of stem and progenitor cells. It is primarily produced by stromal cells and serves as a signaling molecule that attracts various types of cells, including hematopoietic stem cells, to sites of injury or inflammation. The importance of SDF1 in both physiological and pathological processes has made it a focal point of research in fields such as regenerative medicine, cancer biology, and immunology. Studies have demonstrated that SDF1 is involved in tissue repair, organ development, and the homing of leukocytes during immune responses. Additionally, its dysregulation has been implicated in conditions like cancer metastasis and autoimmune diseases. The development of recombinant SDF1 protein has become a crucial tool for investigating its biological functions and potential therapeutic applications. By producing SDF1 in a recombinant system, researchers can explore its mechanisms of action, assess its role in promoting cell migration and survival, and evaluate its potential in enhancing tissue repair and regeneration. As interest in SDF1 continues to grow, understanding its complex nature and developing strategies to manipulate its signaling pathways could pave the way for novel treatments for various diseases. Overall, research on recombinant SDF1 protein contributes to the broader understanding of cell communication and migration, offering insights that may lead to future advancements in medical therapies and regenerative strategies.
