Cat: PA1000-2856

Recombinant Human SDCBP Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SDCBP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SDC4;Syndecan-4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O00560

  • Expression Region

    1-298aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMSLYPSLEDLKVDKVIQAQTAFSANPANPA ILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQG QLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLK SIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQ AFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARN GLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIK RMAPSIMKSLMDHTIPEV

  • Molecular Weight

    35 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The research on SDCBP (syndecan-binding protein) recombinant proteins has gained significant attention due to their crucial role in cellular signaling, adhesion, and migration. SDCBP is known to interact with syndecans, a family of membrane-associated heparan sulfate proteoglycans that participate in various biological processes, including development, wound healing, and cancer progression. Understanding the molecular mechanisms by which SDCBP influences syndecan signaling and functions could provide insights into disease mechanisms and potential therapeutic targets. The production of recombinant SDCBP proteins is essential for conducting detailed biochemical and biophysical studies, as well as for developing assays to evaluate its functional roles in cellular contexts. Additionally, the ability to manipulate SDCBP levels may offer novel strategies for modulating syndecan-related pathways in research and therapeutic applications. Thus, the exploration of SDCBP recombinant proteins stands at the intersection of cell biology and therapeutic development, promising advancements in understanding syndecan-mediated processes in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US