Analytical Data
-
Gene name
SCO2
- Application
-
Alternative Names
SCO2;Protein SCO2 homolog. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43819
-
Expression Region
42-266aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGPAETGGQGQPQGPGLRTRLLITGLFGAG LGGAWLALRAEKERLQQQKRTEALRQAAVGQGDFHLLDHRGRARCKADFR GQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPE RDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDY IVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSVLS
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of SCO2 (Synthesis of Cytochrome Oxidase 2) recombinant protein has emerged as a significant area of research due to its critical role in mitochondrial biology and energy metabolism. SCO2 is a nuclear-encoded protein essential for the biogenesis and maturation of cytochrome c oxidase (CCO), the terminal enzyme in the mitochondrial oxidative phosphorylation pathway. Mutations in the SCO2 gene are associated with severe mitochondrial disorders, leading to conditions such as hypertrophic cardiomyopathy and encephalopathy, underscoring the importance of understanding its function and mechanisms. Recombinant DNA technology allows for the production of SCO2 in various expression systems, enabling researchers to study its structure, interaction with other mitochondrial proteins, and its role in CCO assembly and activity. Furthermore, the availability of recombinant SCO2 opens new avenues for potential therapeutic interventions in mitochondrial diseases caused by SCO2 deficiencies. Enhanced understanding of its protein interactions and regulatory mechanisms may lead to the development of targeted treatments or gene therapies, emphasizing the relevance of this research in both basic science and clinical applications.











