Analytical Data
-
Gene name
NINJ2
- Application
-
Alternative Names
NINJ2; Ninjurin-2; Nerve injury-induced protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NZG7
-
Expression Region
1-142 aa
-
AA Sequence
MESARENIDLQPGSSDPRSQPINLNHYATKKSVAESMLDVALFMSNAMRLKAVLEQGPSS HYYTTLVTLISLSLLLQVVIGVLLVVIARLNLNEVEKQWRLNQLNNAATILVFFTVVINV FITAFGAHKTGFLAARASRNPL
-
Molecular Weight
15.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NINJ2, or Ninjas Protein 2, is a relatively understudied member of the Ninjurin family, which plays a pivotal role in neural development and injury response. Found in both humans and mice, NINJ2 has been implicated in various neurological processes, including cell adhesion, axonal growth, and the regulation of neuronal survival. Recent research has highlighted its potential involvement in neurodegenerative diseases, where aberrant expression of NINJ2 may influence the progression of disorders like Alzheimer's and Parkinson's diseases. Furthermore, studies suggest that NINJ2 interacts with signaling pathways crucial for neuronal repair, making it a promising candidate for developing therapeutic strategies aimed at enhancing neural regeneration. Investigating the structure and function of NINJ2, particularly through the study of its recombinant protein, could provide valuable insights into its mechanisms of action and its potential role as a biomarker for neuronal injury or disease. As the field of neuroscience advances, understanding the molecular dynamics of NINJ2 could pave the way for novel interventions that aim to mitigate neuronal damage and support recovery in various neurodegenerative conditions. The burgeoning interest in NINJ2 underscores the need for comprehensive studies to unravel its functions and therapeutic potential.
