Analytical Data
-
Gene name
RPA2
- Application
-
Alternative Names
POLR1B;DNA-directed RNA polymerase I subunit RPA2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P15927
-
Expression Region
1-270aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMWNSGFESYGSSSYGGAGGYTQSPGGF GSPAPSQAEKKSRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIV GIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVVPPETYVK VAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPS AGRAPISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNF QDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RPA2, or Replication Protein A2, is a crucial component of the eukaryotic replication protein A complex, which plays a significant role in DNA replication, repair, and recombination. It binds single-stranded DNA and assists in stabilizing the unwound DNA helix during replication and in the repair process following DNA damage. Research on RPA2 has gained prominence, particularly in cancer biology, as it is closely linked to the cellular response to DNA damage and the maintenance of genomic stability. Alterations in RPA2 expression or function can lead to genomic instability, which is a hallmark of many cancers. Additionally, RPA2 is involved in various cellular processes such as cell cycle regulation and apoptosis, furthering its significance as a target for therapeutic intervention. In recent studies, the focus has shifted towards understanding the precise mechanisms through which RPA2 interacts with other proteins and its role in the cellular response to genotoxic stress. The development of RPA2 recombinant proteins has allowed researchers to investigate its structural features and functional dynamics, providing insights that could lead to novel cancer treatment strategies and enhance our understanding of cellular responses to DNA damage. Overall, the study of RPA2 and its associated pathways is critical for developing effective cancer therapies and elucidating fundamental cellular processes.
