Cat: PA1000-2750

Recombinant Human RPA2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RPA2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    POLR1B;DNA-directed RNA polymerase I subunit RPA2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P15927

  • Expression Region

    1-270aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMWNSGFESYGSSSYGGAGGYTQSPGGF GSPAPSQAEKKSRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIV GIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVVPPETYVK VAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPS AGRAPISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNF QDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE

  • Molecular Weight

    32 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RPA2, or Replication Protein A2, is a crucial component of the eukaryotic replication protein A complex, which plays a significant role in DNA replication, repair, and recombination. It binds single-stranded DNA and assists in stabilizing the unwound DNA helix during replication and in the repair process following DNA damage. Research on RPA2 has gained prominence, particularly in cancer biology, as it is closely linked to the cellular response to DNA damage and the maintenance of genomic stability. Alterations in RPA2 expression or function can lead to genomic instability, which is a hallmark of many cancers. Additionally, RPA2 is involved in various cellular processes such as cell cycle regulation and apoptosis, furthering its significance as a target for therapeutic intervention. In recent studies, the focus has shifted towards understanding the precise mechanisms through which RPA2 interacts with other proteins and its role in the cellular response to genotoxic stress. The development of RPA2 recombinant proteins has allowed researchers to investigate its structural features and functional dynamics, providing insights that could lead to novel cancer treatment strategies and enhance our understanding of cellular responses to DNA damage. Overall, the study of RPA2 and its associated pathways is critical for developing effective cancer therapies and elucidating fundamental cellular processes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US