Analytical Data
-
Gene name
ROBLD3
- Application
-
Alternative Names
LAMTOR2;MAPBPIP;ROBLD3;Ragulator complex Protein LAMTOR2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y2Q5
-
Expression Region
1-125aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMLRPKALTQVLSQANTGGVQSTLLLN NEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDC MEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLTQVAAS
-
Molecular Weight
16 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ROBLD3 (Robo-Binding Protein 3) is a protein that has been the focus of extensive research due to its potential role in various cellular processes and its implications in health and disease. Initially identified in studies related to the development of the nervous system, ROBLD3 has garnered attention for its involvement in protein-protein interactions and its function as a regulator of signaling pathways. Notably, it has been implicated in tumorigenesis and various cancers, where its expression levels appear to correlate with disease progression and patient prognosis. Furthermore, emerging evidence suggests that ROBLD3 may play a significant role in immune responses, making it a target of interest for understanding autoimmune disorders and inflammatory diseases. Investigating the mechanisms through which ROBLD3 exerts its functions at the molecular level is crucial, as this could unveil new therapeutic avenues for diseases characterized by aberrant cell signaling or immune dysregulation. Researchers are employing various techniques, including recombinant protein production, structural biology, and functional assays, to elucidate the functional properties of ROBLD3 and its interactions with other cellular components. This ongoing research aims to harness the full potential of ROBLD3 as a biomarker for disease and a potential therapeutic target, thereby enhancing our understanding of its biological significance in human health and disease.
