Analytical Data
-
Gene name
CYP3A2
- Application
-
Alternative Names
CYP3A2；Cyp3a-2；Cyp3a11；Cytochrome P450 3A2
-
Species
Rat
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P05183
-
Expression Region
1-504aa
-
AA Sequence
MDLLSALTLETWVLLAVILVLLYRLGTHRHGIFKKQGIPGPKPLPFLGTVLNYYKGLGRFDMECYKKYGKIWGLFDGQTPVFAIMDTEMIKNVLVKECFSVFTNRRDFGPVGIMGKAVSVAKDEEWKRYRALLSPTFTSGRLKEMFPIIEQYGDILVKYLKQEAETGKPVTMKKVFGAYSMDVITSTSFGVNVDSLNNPKDPFVEKTKKLLRFDFFDPLFLSVVLFPFLTPIYEMLNICMFPKDSIAFFQKFVHRIKETRLDSKHKHRVDFLQLMLNAHNNSKDEVSHKALSDVEIIAQSVIFIFAGYETTSSTLSFVLYFLATHPDIQKKLQEEIDGALPSKAPPTYDIVMEMEYLDMVLNETLRLYPIGNRLERVCKKDIELDGLFIPKGSVVTIPTYALHHDPQHWPKPEEFHPERFSKENKGSIDPYVYLPFGNGPRNCIGMRFALMNMKLALTKVLQNFSFQPCKETQIPLKLSRQAILEPEKPIVLKVLPRDAVINGA
-
Molecular Weight
57.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CYP3A2 is an important member of the cytochrome P450 enzyme family, primarily known for its role in the metabolism of various drugs and xenobiotics. The study of CYP3A2 is particularly relevant in pharmacology, as it affects the bioavailability and clearance of many therapeutic agents. This enzyme is predominantly expressed in the liver and plays a crucial role in the oxidative metabolism of steroids, fatty acids, and a wide range of pharmaceutical compounds. Variations in CYP3A2 activity can significantly influence individual drug responses, leading to altered therapeutic efficacy and toxicity. Recombinant CYP3A2 proteins have been generated to facilitate detailed studies of the enzyme's biochemical properties, substrate specificity, and interactions with inhibitors. These recombinant proteins serve as valuable tools for drug development, enabling researchers to predict drug metabolism and identify potential drug-drug interactions. Furthermore, understanding the structure-function relationship of CYP3A2 can guide the design of novel drugs with improved safety profiles. Overall, the research on recombinant CYP3A2 proteins emphasizes the enzyme's significance in personalized medicine and its implications for the safe and effective use of pharmacotherapy.
