Analytical Data
-
Gene name
CHRNg
- Application
-
Alternative Names
CHRNg；ACHRG；Acetylcholine receptor subunit gamma
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P07510
-
Expression Region
1-517aa
-
AA Sequence
MHGGQGPLLLLLLLAVCLGAQGRNQEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTTNVWIEMQWCDYRLRWDPRDYEGLWVLRVPSTMVWRPDIVLENNVDGVFEVALYCNVLVSPDGCIYWLPPAIFRSACSISVTYFPFDWQNCSLIFQSQTYSTNEIDLQLSQEDGQTIEWIFIDPEAFTENGEWAIQHRPAKMLLDPAAPAQEAGHQKVVFYLLIQRKPLFYVINIIAPCVLISSVAILIHFLPAKAGGQKCTVAINVLLAQTVFLFLVAKKVPETSQAVPLISKYLTFLLVVTILIVVNAVVVLNVSLRSPHTHSMARGVRKVFLRLLPQLLRMHVRPLAPAAVQDTQSRLQNGSSGWSITTGEEVALCLPRSELLFQQWQRQGLVAAALEKLEKGPELGLSQFCGSLKQAAPAIQACVEACNLIACARHQQSHFDNGNEEWFLVGRVLDRVCFLAMLSLFICGTAGIFLMAHYNRVPALPFPGDPRPYLPSPD
-
Molecular Weight
57.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CHRNg, or Chimeric Receptor Nucleotide G, is a recombinant protein that has emerged as a focal point in the field of immunology and therapeutic development. The research surrounding CHRNg is driven by the increasing need for innovative solutions to address various diseases, particularly those involving immune dysregulation and cancer. This protein is designed to act as a chimeric antigen receptor (CAR), integrating the specificity of monoclonal antibodies with the signaling capacity of T cell receptors. Researchers are exploring CHRNg for its potential to enhance T cell activation and improve the efficacy of adoptive cell therapies, particularly in directing immune responses against tumor cells. The engineering of CHRNg allows for tailored approaches to target specific antigens, thus optimizing therapeutic outcomes while minimizing off-target effects. As the understanding of its molecular mechanisms unfolds, the ongoing studies aim to elucidate its role in T cell dynamics and the overall immune response, thereby contributing to the development of next-generation immunotherapeutics. Ultimately, the research on CHRNg represents a significant stride toward harnessing the power of the immune system for effective disease management and therapeutic interventions.
