Analytical Data
-
Gene name
JUNB
- Application
-
Alternative Names
JUNB;Transcription factor JunB
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P17275
-
Expression Region
1-347aa
-
AA Sequence
MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSL KAPGARGPGPEGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVIT TTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFVKALDDLHKMN HVTPPNVSLGATGGPPAGPGGVYAGPEPPPVYTNLSSYSPASASSGGAGA AVGTGSSYPTTTISYLPHAPPFAGGHPAQLGLGRGASTFKEEPQTVPEAR SRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKV KTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF
-
Molecular Weight
62 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
JUNB is a member of the Jun family of transcription factors, which are key regulators of cellular processes such as proliferation, differentiation, and apoptosis. Recent studies have highlighted the crucial role of JUNB in various physiological and pathological conditions, including immune responses, cancer progression, and tissue repair. The interest in JUNB as a target for therapeutic intervention has surged, particularly due to its involvement in the regulation of genes associated with inflammation and stress responses. Researchers have increasingly focused on recombinant JUNB proteins to elucidate their functional mechanisms and interactions with other signaling pathways. The ability to produce JUNB as a recombinant protein allows for in-depth studies of its structure, post-translational modifications, and biological activities in a controlled environment. This knowledge could lead to new insights into how JUNB influences gene expression under different cellular contexts. Moreover, understanding the pathways regulated by JUNB may pave the way for the development of novel strategies for the treatment of diseases where JUNB dysregulation is implicated. Researchers aim to utilize recombinant JUNB proteins to explore their potential roles in therapeutic applications, emphasizing the protein's significance in cellular regulation and its promise as a target for future biomedical advancements.
