Analytical Data
-
Gene name
NDUFA1
- Application
-
Alternative Names
NDUFA1; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1; Complex I-MWFE; CI-MWFE; NADH-ubiquinone oxidoreductase MWFE subunit
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15239
-
Expression Region
1-24-70 aa
-
AA Sequence
AYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID
-
Molecular Weight
30.91 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NDUFA1, or NADH-ubiquinone oxidoreductase subunit A1, is a crucial component of the mitochondrial respiratory chain, specifically part of Complex I. This enzyme plays a pivotal role in cellular energy production by facilitating the transfer of electrons from NADH to ubiquinone, ultimately contributing to ATP synthesis through oxidative phosphorylation. Mutations in the NDUFA1 gene have been linked to various mitochondrial diseases, leading to a spectrum of clinical manifestations ranging from psychomotor retardation to cardiomyopathy. Due to its essential role in mitochondrial function and energy metabolism, NDUFA1 has garnered significant research interest, particularly in the context of developing therapeutic strategies for mitochondrial disorders. Recombinant protein studies of NDUFA1 allow for enhanced understanding of its biochemical properties, functional mechanisms, and interactions within the respiratory chain. These studies may also aid in the elucidation of the pathogenic mechanisms associated with NDUFA1-related diseases. By generating and characterizing NDUFA1 recombinant proteins, researchers can explore the structure-function relationship of this subunit and its influence on Complex I activity. Furthermore, these investigations may lead to potential biotechnological applications, such as developing enzyme replacement therapies or small molecule compounds aimed at restoring or enhancing the function of NDUFA1 in affected individuals. Overall, research on NDUFA1 recombinant proteins is vital for advancing our understanding of mitochondrial dysfunction and developing novel interventions for the treatment of related health conditions.
