Cat: PA2000-1063

Recombinant Human aMSH Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    aMSH

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    aMSH;AMSHLP;KIAA1373;AMSH-like protease

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O95630

  • Expression Region

    1-424aa

  • AA Sequence

    MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIY SEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAF PKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVA QQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDL EKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPT IDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVL IPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLH THCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSK DPPLFCSCSHVTVVDRAVTITDLR

  • Molecular Weight

    54 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Alpha-melanocyte-stimulating hormone (aMSH) is a peptide that plays a crucial role in the regulation of various physiological functions, including pigmentation, appetite control, and inflammatory responses. Research on aMSH has gained attention due to its potential therapeutic applications, particularly in the fields of obesity, skin disorders, and autoimmune diseases. The production of recombinant aMSH has become a focal point in biomedical research, as it allows for the generation of large quantities of the peptide for both experimental and clinical use. Utilizing techniques such as recombinant DNA technology and protein expression systems, researchers can produce aMSH in a cost-effective and efficient manner. The exploration of aMSH's mechanisms of action at the molecular and cellular levels has revealed insights into its interactions with melanocortin receptors, paving the way for novel drug development. Furthermore, studies investigating the role of aMSH in neuroinflammation and neuroprotection have opened new avenues for treating neurological disorders. Overall, the ongoing research into recombinant aMSH not only enhances our understanding of its biological significance but also holds promise for innovative therapeutic strategies targeting a range of health conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US