Analytical Data
-
Gene name
REXO2
- Application
-
Alternative Names
REXO4;PMC2;XPMC2H;RNA exonuclease 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y3B8
-
Expression Region
26-237aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSVREGGAAMAAGESMAQRMVWVDLEMTG LDIEKDQIIEMACLITDSDLNILAEGPNLIIKQPDELLDSMSDWCKEHHG KSGLTKAVKESTITLQQAEYEFLSFVRQQTPPGLCPLAGNSVHEDKKFLD KYMPQFMKHLHYRIIDVSTVKELCRRWYPEEYEFAPKKAASHRALDDISE SIKELQFYRNNIFKKKIDEKKRKIIENGENEKTVS
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
REXO2, a member of the two-hybrid Ribonuclease family, has garnered attention in recent years due to its potential roles in various biological processes and its implications in diseases. Characterized as a cytoplasmic ribonuclease, REXO2 is involved in RNA processing and degradation, which are critical for maintaining cellular RNA homeostasis. Its ability to modulate RNA stability and turnover positions REXO2 as a key player in gene expression regulation and cellular responses to stressors. Research has indicated that dysregulation of REXO2 may contribute to the pathogenesis of several diseases, including cancer, highlighting its significance in therapeutic contexts. Moreover, REXO2's interaction with other cellular components and its influence on RNA metabolism underscore the necessity for a deeper understanding of its structure and function. Current studies focus on the characterization of REXO2's enzymatic activity, its structural dynamics, and the exploration of its potential as a target for drug development. As ongoing investigations aim to elucidate the molecular mechanisms underlying REXO2's action, this research holds promise for advancing our knowledge of RNA biology and its implications in health and disease.
