Analytical Data
-
Gene name
NBR2
- Application
-
Alternative Names
NBR2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15453
-
Expression Region
1-82 aa
-
AA Sequence
MWKGGRSHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKDLSSGFPSFLTSSILWKSAVVREPHISPHQAPPYKTSDCIT
-
Molecular Weight
34.65 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NBR2 (Nuclear protein binding to RBPJ) is a protein that has garnered considerable interest in the field of molecular biology due to its role in various cellular processes, particularly in signal transduction and gene regulation. It is involved in the Notch signaling pathway, which is critical for cell differentiation, proliferation, and apoptosis. Dysregulation of the Notch pathway has been implicated in several diseases, including cancer. Recent studies have indicated that NBR2 can modulate the activity of the transcription factor RBPJ, affecting its ability to regulate target genes associated with cell fate decisions. The understanding of NBR2's function is essential for elucidating its potential as a therapeutic target. Notably, the generation of recombinant NBR2 protein has become a pivotal method for studying its biological functions and interactions with other cellular components. This research not only provides insight into the mechanistic aspects of NBR2 but also opens avenues for potential applications in targeted therapies for diseases linked to Notch signaling dysregulation. Consequently, the exploration of NBR2 recombinant protein serves as a foundational step in both basic research and the development of innovative medical interventions.
