Cat: PA1000-2691

Recombinant Human RCN1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RCN1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RCN1;RCN;Reticulocalbin-1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q15293

  • Expression Region

    30-331aa

  • AA Sequence

    MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSELEKPTVRKERVVR PDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDR IDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEY KQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREE FTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGP EPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVY ESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

  • Molecular Weight

    40 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Recombinant RCN1 (Regulator of Calcium and Nucleotides 1) protein has garnered substantial attention in recent years due to its critical role in cellular calcium signaling and its involvement in various physiological and pathological processes. RCN1 functions as a calcium-binding protein that regulates the activity of several target proteins, influencing cellular responses to calcium fluctuations. Research has suggested that RCN1 is implicated in numerous diseases, including neurodegenerative disorders, cancer, and cardiovascular diseases, making it a potential therapeutic target. The ability to produce RCN1 as a recombinant protein allows researchers to study its structure, function, and interactions with other cellular components in detail. By understanding the molecular mechanisms underlying RCN1's activity, scientists aim to develop novel strategies for disease intervention and therapeutic applications. Furthermore, the exploration of RCN1's role in calcium homeostasis sheds light on fundamental cellular processes, potentially leading to advancements in biotechnology and drug development. As research continues, the recombinant expression and purification of RCN1 are expected to provide deeper insights into its biological significance and pave the way for innovative approaches in medical science.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US