Analytical Data
-
Gene name
NAT8B
- Application
-
Alternative Names
NAT8B; CML2; Putative N-acetyltransferase 8B; Acetyltransferase 1; ATase1; Camello-like protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UHF3
-
Expression Region
1-227 aa
-
AA Sequence
MAPYHIRKYQESDRKSVVGLLSGGMAEHAPATFRRLLKLPRTLILLLGGALALLLVSGSW ILALVFSLSLLPALWFLAKKPWTRYVDIALRTDMSDITKSYLSECGSCFWVAESEEKVVG TVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKALVRTVLQFARDQGYSEVVLDTSNI QLSAMGLYQSLGFKKTGQSFFHVWARLVDLHTVHFIYHLPSAQAGRL
-
Molecular Weight
25.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NAT8B (N-acetyltransferase 8B) is a member of the N-acetyltransferase family, which plays a crucial role in the metabolism of drugs and endogenous compounds by catalyzing the transfer of an acetyl group from acetyl-coenzyme A to various substrates. The study of NAT8B has gained significance in recent years due to its potential implications in various diseases, including liver dysfunction and certain metabolic disorders. Variants in the NAT8B gene have been associated with altered enzyme activity, which may affect drug metabolism and predispose individuals to adverse drug reactions. Furthermore, NAT8B has been implicated in the pathophysiology of conditions such as non-alcoholic fatty liver disease (NAFLD) and hepatocellular carcinoma. Understanding the structure and function of NAT8B, as well as the mechanisms underlying its regulation, is essential for developing targeted therapies and personalized medicine approaches. Research on NAT8B recombinant proteins is pivotal to elucidating its enzymatic properties and interactions with potential inhibitors or substrate molecules. This knowledge may offer insights into therapeutic strategies to modulate NAT8B activity for better management of related diseases and improving pharmacotherapy outcomes. Overall, the exploration of NAT8B recombinant proteins serves as a cornerstone for advancing our understanding of its biological functions and clinical significance.
