Analytical Data
-
Gene name
NAPRT1
- Application
-
Alternative Names
FHA HIT interacting protein; FHA-HIT-interacting protein; FHIP; NAPRT1; NAPRTase; Nicotinate phosphoribosyltransferase; Nicotinate phosphoribosyltransferase domain containing 1; Nicotinate phosphoribosyltransferase domain-containing protein 1; Nicotinic acid phosphoribosyltransferase; PNCB_HUMAN; PP3856
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6XQN6
-
Expression Region
229-538 aa
-
AA Sequence
MLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQEGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRVWPPGAQEPCTVRPAQVEPLLRLCLQQGQLCEPLPSLAESRALAQLSLSRLSPEHRRLRSPAQYQVVLSERLQALVNSLCAGQSP
-
Molecular Weight
35.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NAPRT1, or nicotinate adenine dinucleotide phosphate (NADP+) riboswitch 1, is a member of the nicotinamide adenine dinucleotide (NAD) biosynthetic pathway that plays a crucial role in cellular metabolism and energy production. Recent research has highlighted the significance of NAPRT1 in several biological processes, including its involvement in the regulation of cellular responses to stress and in maintaining cellular NAD+ levels. Abnormal expression or dysfunction of NAPRT1 has been linked to various diseases, including metabolic disorders and certain types of cancer, emphasizing the need for a better understanding of its mechanisms. The recombinant expression of NAPRT1 protein facilitates the study of its structure-function relationships, as well as its interactions with other metabolic pathways. This research not only aids in elucidating the physiological roles of NAPRT1 but also opens avenues for therapeutic interventions targeting NAD+ metabolism. Advancements in recombinant protein technologies have enabled researchers to produce NAPRT1 in sufficient quantities for functional assays and structural characterization. By employing techniques such as X-ray crystallography and nuclear magnetic resonance (NMR), scientists are able to investigate the three-dimensional structure of NAPRT1, providing insights into its catalytic mechanisms and binding properties. Understanding NAPRT1 at the molecular level is essential for developing potential biomarkers and therapeutic targets for diseases associated with NAD+ metabolism, positioning it as a key player in the ongoing research into metabolic regulation and disease management.
