Analytical Data
-
Gene name
RBM3
- Application
-
Alternative Names
RBM3;RNPL;RNA-binding Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P98179
-
Expression Region
1-157aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMSSEEGKLFVGGLNFNTDEQALEDHFS SFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQI RVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGY GYGRSRDYNGRNQGGYDRYSGGNYRDNYDN
-
Molecular Weight
19 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RBM3 (RNA-binding motif protein 3) is a member of the RNA-binding protein family, playing a crucial role in various biological processes, including stress response, cell differentiation, and neuroprotection. Research has shown that RBM3 is highly upregulated in response to cellular stressors such as hypoxia and heat shock, suggesting its potential involvement in protecting cells from damage. Furthermore, its expression is correlated with enhanced survival in various tissue types, including neurons, highlighting its possible role in neurodegenerative diseases. The interest in RBM3 has grown as studies indicate that it may influence RNA metabolism, splicing, and stability, potentially making it a target for therapeutic interventions. Recent advancements in recombinant protein technology have enabled the purification and characterization of RBM3, providing valuable insights into its structure and function. Investigating the biochemical properties of RBM3 can yield a better understanding of its role in cellular stress responses and its implications in health and disease, paving the way for novel approaches in treating conditions such as ischemia and neurodegeneration.
