Cat: PA1000-2680

Recombinant Human RBM3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RBM3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RBM3;RNPL;RNA-binding Protein 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P98179

  • Expression Region

    1-157aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMSSEEGKLFVGGLNFNTDEQALEDHFS SFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQI RVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGY GYGRSRDYNGRNQGGYDRYSGGNYRDNYDN

  • Molecular Weight

    19 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RBM3 (RNA-binding motif protein 3) is a member of the RNA-binding protein family, playing a crucial role in various biological processes, including stress response, cell differentiation, and neuroprotection. Research has shown that RBM3 is highly upregulated in response to cellular stressors such as hypoxia and heat shock, suggesting its potential involvement in protecting cells from damage. Furthermore, its expression is correlated with enhanced survival in various tissue types, including neurons, highlighting its possible role in neurodegenerative diseases. The interest in RBM3 has grown as studies indicate that it may influence RNA metabolism, splicing, and stability, potentially making it a target for therapeutic interventions. Recent advancements in recombinant protein technology have enabled the purification and characterization of RBM3, providing valuable insights into its structure and function. Investigating the biochemical properties of RBM3 can yield a better understanding of its role in cellular stress responses and its implications in health and disease, paving the way for novel approaches in treating conditions such as ischemia and neurodegeneration.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US