Analytical Data
-
Gene name
RAP2B
- Application
-
Alternative Names
RAP2B;Ras-related Protein Rap-2b
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P61225
-
Expression Region
1-183aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMREYKVVVLGSGGVGKSALTVQFVTGS FIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQG FILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVS YGEGKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCC SACVIL
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RAP2B, a member of the RAS oncogene family, plays a crucial role in various cellular processes, including cell proliferation, differentiation, and survival. It functions as a molecular switch, cycling between an active GTP-bound form and an inactive GDP-bound form, thereby regulating key signaling pathways involved in cancer development and progression. Given its significant involvement in cellular signaling, RAP2B has emerged as a potential therapeutic target in cancer research. Recent studies have highlighted its overexpression in several types of cancers, suggesting a correlation between RAP2B levels and tumorigenicity. Researchers have been investigating RAP2B's structural properties and binding affinities, leading to the development of recombinant RAP2B proteins for functional assays. The expression and purification of these recombinant proteins are essential for elucidating RAP2B's biochemical properties and understanding its role in oncogenic signaling pathways. Furthermore, such studies may pave the way for novel therapeutic strategies aimed at inhibiting RAP2B activity, offering hope for improved cancer treatment options. As our understanding of RAP2B's mechanisms and interactions expands, it may provide valuable insights into the complexity of cancer biology and lead to innovative approaches in combating this disease.
