Analytical Data
-
Gene name
RAP2A
- Application
-
Alternative Names
RAP2A;Ras-related Protein Rap-2a
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P10114
-
Expression Region
1-180aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMREYKVVVLGSGGVGKSALTVQFVTGTFIE KYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFIL VYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSE GRALAEEWGCPFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSAC
-
Molecular Weight
22 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RAP2A (Ras-related protein 2A) is a member of the RAS superfamily of small GTPases, which play crucial roles in various cellular processes, including signal transduction, cell proliferation, and differentiation. Research into RAP2A has gained momentum due to its involvement in numerous biological functions and its potential implications in cancer and other diseases. Studies have shown that RAP2A regulates cytoskeletal dynamics, influences cell motility, and is implicated in the modulation of certain signaling pathways. Furthermore, abnormalities in RAP2A expression and function have been linked to various malignancies, suggesting that it may serve as a potential therapeutic target. The heterogeneity and complexity of its regulatory mechanisms necessitate an in-depth understanding of RAP2A at the molecular level. Thus, efforts to produce recombinant RAP2A protein have become essential for investigating its biochemical properties, interaction partners, and functional roles within the cell. The successful expression and purification of RAP2A as a recombinant protein represent a pivotal step in elucidating its mechanisms in health and disease, facilitating the development of targeted interventions in cancer therapy and beyond.
