Cat: PA1000-2644

Recombinant Human RAC3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RAC3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RAC3;Ras-related C3 botulinum toxin substrate 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P60763

  • Expression Region

    1-189aa

  • AA Sequence

    MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKP VNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPE VRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIG SVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKC

  • Molecular Weight

    21 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RAC3, a member of the Rho family of GTPases, plays a crucial role in various cellular processes, including cell migration, proliferation, and cytoskeletal dynamics. Its dysregulation has been implicated in multiple diseases, particularly cancer, where elevated RAC3 expression is associated with enhanced tumor growth and metastasis. Understanding the function and regulation of RAC3 is vital for developing potential therapeutic strategies. Recent studies have focused on elucidating the molecular mechanisms underlying RAC3 signaling pathways and its interactions with other proteins. Additionally, the emerging role of RAC3 in mediating signal transduction from growth factor receptors is garnering interest, as it may provide insights into its contribution to oncogenic processes. The generation of recombinant RAC3 protein has become an essential tool to investigate its biochemical properties, downstream signaling, and interactions within cellular contexts. Researchers are employing advanced techniques such as X-ray crystallography and cryo-electron microscopy to discern the structural dynamics of RAC3, contributing to a deeper understanding of how its activity is regulated and its potential as a therapeutic target. Through these studies, the significance of RAC3 in both normal physiology and disease states is being unveiled, highlighting the need for ongoing research in this promising area.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US