Cat: PA1000-2639

Recombinant Human RABL5 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RABL5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IFT22;RABL5;Intraflagellar transport Protein 22 homolog

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9H7X7

  • Expression Region

    1-185aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMLKAKILFVGPCESGKTVLANFLTESS DITEYSPTQGVRILEFENPHVTSNNKGTGCEFELWDCGGDAKFESCWPAL MKDAHGVVIVFNADIPSHRKEMEMWYSCFVQQPSLQDTQCMLIAHHKPGS GDDKGSLSLSPPLNKLKLVHSNLEDDPEEIRMEFIKYLKSIINSMSESRD REEMSIMT

  • Molecular Weight

    23 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RABL5, a member of the Rab GTPase family, plays a crucial role in cellular processes such as membrane trafficking, cytoskeletal dynamics, and signaling pathways. Recent studies have highlighted its involvement in various biological functions, including regulation of the cell cycle and mitotic progression. Dysregulation of RABL5 has been linked to several diseases, particularly cancers, where it may contribute to tumorigenesis and metastasis. Due to its pivotal role in cellular homeostasis, RABL5 has garnered attention as a potential therapeutic target. Research on RABL5 recombinant protein aims to elucidate its functional mechanisms and interactions within the cell, providing insights into its contribution to disease states. By producing this protein in a recombinant form, scientists can perform detailed biochemical analyses and functional assays, which are essential for understanding RABL5's role in health and disease. These studies may pave the way for novel therapeutic strategies that exploit the modulation of RABL5 activity to combat various pathologies, thus enriching our understanding of rab family proteins in cellular regulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US