Analytical Data
-
Gene name
RABL5
- Application
-
Alternative Names
IFT22;RABL5;Intraflagellar transport Protein 22 homolog
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H7X7
-
Expression Region
1-185aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMLKAKILFVGPCESGKTVLANFLTESS DITEYSPTQGVRILEFENPHVTSNNKGTGCEFELWDCGGDAKFESCWPAL MKDAHGVVIVFNADIPSHRKEMEMWYSCFVQQPSLQDTQCMLIAHHKPGS GDDKGSLSLSPPLNKLKLVHSNLEDDPEEIRMEFIKYLKSIINSMSESRD REEMSIMT
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RABL5, a member of the Rab GTPase family, plays a crucial role in cellular processes such as membrane trafficking, cytoskeletal dynamics, and signaling pathways. Recent studies have highlighted its involvement in various biological functions, including regulation of the cell cycle and mitotic progression. Dysregulation of RABL5 has been linked to several diseases, particularly cancers, where it may contribute to tumorigenesis and metastasis. Due to its pivotal role in cellular homeostasis, RABL5 has garnered attention as a potential therapeutic target. Research on RABL5 recombinant protein aims to elucidate its functional mechanisms and interactions within the cell, providing insights into its contribution to disease states. By producing this protein in a recombinant form, scientists can perform detailed biochemical analyses and functional assays, which are essential for understanding RABL5's role in health and disease. These studies may pave the way for novel therapeutic strategies that exploit the modulation of RABL5 activity to combat various pathologies, thus enriching our understanding of rab family proteins in cellular regulation.











