Cat: PA1000-2622

Recombinant Human RAB32 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RAB32

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RAB32;Ras-related Protein Rab-32

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q13637

  • Expression Region

    1-225aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSHMAGGGAGDPGLGAAAAPAPETREHLF KVLVIGELGVGKTSIIKR YVHQLFSQHYRATIGVDFALKVLNWDSRTL VRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLK WKS DLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFE TSAKDNINIEEAARFLVEKILV NHQSFPNEENDVDKIKLDQETLRAEN KSQCC

  • Molecular Weight

    28 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RAB32 is a member of the RAB family of small GTPases, which are critical regulators of intracellular trafficking and membrane dynamics. This protein has garnered attention due to its involvement in various cellular processes, including organelle biogenesis, mitochondrial dynamics, and autophagy. Recent studies have highlighted RAB32's role in the regulation of melanosome transport in melanocytes, suggesting its importance in pigmentation and skin physiology. Furthermore, dysregulation of RAB32 has been implicated in several pathological conditions, including cancer and neurodegenerative diseases. Researchers have been focusing on characterizing RAB32 through recombinant protein technology to elucidate its specific functions and interactions within the cell. The generation of RAB32 recombinant proteins allows for advanced biophysical and biochemical analyses, facilitating the understanding of its mechanism of action in cellular trafficking. As such, RAB32 represents a promising target for therapeutic intervention in diseases where intracellular transport is disrupted. Understanding RAB32's function may provide insights into the development of novel strategies for the treatment of related disorders, making it a topic of significant interest in cell biology and medical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US