Analytical Data
-
Gene name
RAB2B
- Application
-
Alternative Names
RAB2B;Ras-related Protein Rab-2B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WUD1
-
Expression Region
1-216aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMTYAYLFKYIIIGDTGVGKSCLLLQF TDKRFQPVHDLTIGVEFGARMVNIDGKQIKLQIWDTAGQESFRSITRSYY RGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESR RDVKREEGEAFAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGLF DVHNEANGIKIGPQQSISTSVGPSASQRNSRDIGSNSGCC
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RAB2B is a member of the RAB family of small GTPases, which play crucial roles in intracellular vesicle trafficking, protein sorting, and cellular signaling. Research into RAB2B has gained traction due to its involvement in various physiological and pathological processes, including cell metabolism, neurodegeneration, and cancer progression. It primarily regulates the transport of endosomes and Golgi-derived vesicles, thus influencing the secretion of proteins and lipids essential for cell function. Understanding the mechanisms of RAB2B can elucidate its role in maintaining cellular homeostasis and its potential as a therapeutic target. Recent studies have focused on the recombinant expression of RAB2B protein to facilitate functional analyses, structure-function relationships, and potential drug discovery efforts. This recombinant protein serves as a vital tool for exploring RAB2B's interaction with other cellular components and its impact on vesicle trafficking pathways, ultimately enhancing our understanding of its biological significance and potential implications in disease contexts. With advancements in molecular biology techniques, RAB2B research aims to uncover novel insights into its regulatory mechanisms, paving the way for innovative therapeutic strategies.
