Analytical Data
-
Gene name
MTP18
- Application
-
Alternative Names
HSPC 242; HSPC242; Mitochondrial 18 kDa protein; Mitochondrial fission process protein 1; Mitochondrial fission protein MTP18; Mitochondrial protein 18 kDa; MTFP1; MTFP1_HUMAN; MTP 18; MTP18
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UDX5
-
Expression Region
1-166 aa
-
AA Sequence
MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPEAGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHPIDRSVDFLLDSSLRKLYPTVGKPSSS
-
Molecular Weight
45 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MTP18, or mitochondrial fom-18 protein, has garnered attention in recent years due to its crucial role in mitochondrial dynamics and function. As a key player in maintaining mitochondrial homeostasis, MTP18 is involved in various cellular processes, including apoptosis, energy metabolism, and oxidative stress response. Research indicates that dysregulation of MTP18 can lead to mitochondrial dysfunction, contributing to a range of diseases, particularly neurodegenerative disorders and metabolic syndromes. Consequently, understanding the structure and function of MTP18 at the molecular level is vital for elucidating its role in health and disease. Studies focusing on the recombinant expression of MTP18 have enabled researchers to investigate its biochemical properties and interactions. Furthermore, the availability of purified MTP18 as a recombinant protein facilitates in-depth studies on its contributions to mitochondrial dynamics and its potential as a therapeutic target. As mitochondrial dysfunction remains a significant concern in aging and various pathologies, unraveling the mechanisms by which MTP18 operates is essential for developing novel strategies for intervention and treatment of related diseases.











