Cat: PA1000-2613

Recombinant Human RAB21 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RAB21

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RAB21;KIAA0118;Ras-related Protein Rab-21

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UL25

  • Expression Region

    2-225aa

  • AA Sequence

    MASMTGGQQMGRGHHHHHHENLYFQGGEFAAAGGGGGGAAAAGRAYSFKV VLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAI WDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLG NEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEEL FLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDDEPQAQTSGGGCC SSG

  • Molecular Weight

    28 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RAB21 is a member of the RAB GTPase family, which plays a crucial role in intracellular membrane trafficking, endocytosis, and cytoskeletal dynamics. Research on RAB21 has gained significant attention due to its implications in various biological processes and diseases, including cancer metastasis and neurodegenerative disorders. It is primarily involved in regulating the transport of vesicles and proteins within cells, influencing cellular signaling pathways and organelle maintenance. Recent studies have highlighted the involvement of RAB21 in modulating the immune response and its potential as a therapeutic target. Moreover, the dysregulation of RAB21 has been associated with several pathological conditions, suggesting its pivotal role in cellular homeostasis. The development of recombinant RAB21 protein has provided researchers with valuable tools to elucidate its functional properties, structure-function relationships, and interaction networks within the cell. By employing techniques such as protein expression, purification, and functional assays, scientists aim to characterize RAB21's role in various physiological and pathological contexts, enhancing our understanding of its contributions to cellular behavior. The exploration of RAB21's functions and mechanisms could pave the way for innovative therapeutic strategies, making it a vital area of ongoing research in cell biology and biomedical sciences.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US